| Desktop | 57/100 | ❗ |
| Mobile | 8/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 63 KB | ✔ |
| Compression | 11 KB (-82.1%) | ✔ |
| Text/Html Ratio | 5231 / 64358 (bytes) = 8.13% | ❗ |
| Load Time | 0.44 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 188 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | Yes | ✘ | Images Without ALT | 21 / 26 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| view | 12 | ✘ | ✘ | ✘ |
| products | 11 | ✘ | ✔ | ✘ |
| scenic | 9 | ✘ | ✔ | ✘ |
| lighting | 8 | ✘ | ✘ | ✘ |
| film | 7 | ✘ | ✘ | ✘ |
| overview | 7 | ✘ | ✘ | ✘ |
| projectors | 6 | ✘ | ✘ | ✘ |
| rosco | 6 | ✔ | ✘ | ✘ |
| architectural | 5 | ✘ | ✘ | ✘ |
| beam | 5 | ✘ | ✘ | ✘ |
| broadcast | 5 | ✘ | ✘ | ✘ |
| dance | 5 | ✘ | ✔ | ✘ |
| product | 5 | ✘ | ✔ | ✘ |
| entertainment | 4 | ✘ | ✘ | ✘ |
| industries | 4 | ✘ | ✘ | ✘ |
|
With 0.44 seconds in page load, 63 KB of page size and all other reports below, the rosco.com has a SEO score of 66 out of 100 |
| Title | Rosco |
| Description | Leading global manufacturer of creative solutions including LED fixtures, backdrops, color filters, gobos, fog effects, scenic products and dance floors. |
| Keyword |
| Age | 27 Years, 190 Days |
| Created | 23rd-Feb-1995 |
| Updated | 27th-Jul-2022 |
| Expiry | 24th-Feb-2024 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| rosco.com | A | 3587 | ip:204.232.153.57 |
| rosco.com | NS | 7200 | target:ns15.worldnic.com |
| rosco.com | NS | 7200 | target:ns16.worldnic.com |
| rosco.com | SOA | 7200 | mname:NS15.WORLDNIC.comrname:namehost.WORLDNIC.comserial:122080808refresh:10800retry:3600expire:604800minimum-ttl:3600 |
| rosco.com | MX | 3600 | pri:0target:rosco-com.mail.protection.outlook.com |
| rosco.com | TXT | 3600 | txt:fnm4papr6q9r5ohtuho9m33j0i |
| rosco.com | TXT | 3600 | txt:1bql6j2xb0zf5y40w5m7kg5cjyy2jfkh |
| rosco.com | TXT | 3600 | txt:apple-domain-verification=WW480j109shiYNUa |
| rosco.com | TXT | 3600 | txt:0ed1fe018a66bf06647ca945b9a2902faa98534ece |
| rosco.com | TXT | 3600 | txt:xj48m2g21nyl7ptgmz3zbszkjx0w45zy |
| rosco.com | TXT | 3600 | txt:MS=ms10608213 |
| rosco.com | TXT | 3600 | txt:v=spf1 include:spf.protection.outlook.com include:dnsexit.com -all |
| rosco.com | TXT | 3600 | txt:google-site-verification=JqLxV_XiiNU6--YjvNfK6F4ZNapjC_sBldmpXBodvtw |
|
IP Address Has Reached Rate Limit |
| Server IP | 204.232.153.57 |
| Server Location | United States of America |
| Service Provider | RACKSPACE |
| Domains (TLD) | Status |
|---|---|
| rosco.net | Already Registered |
| rosco.org | Already Registered |
| rosco.biz | Already Registered |
| rosco.io | Already Registered |
| rosco.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| eosco.com | Already Registered |
| dosco.com | Already Registered |
| fosco.com | Already Registered |
| gosco.com | Already Registered |
| tosco.com | Already Registered |
| Ppcra.com |
| Shiawatch.com |
| Worthwebscraping.com |
| Pushingastrollerinheels.com |
| Mypr0xy.com |
| Fargostartuphouse.com |
| Eliosceramica.com |
| Ausablevalleygrangefarmersmarkets.com |
| Oneworldcaring.com |
| 19jt.club |